.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dkf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a heterodimeric complex of RAR and RXR ligand-binding domains. Mol.Cell 5 289-298 2000
    Site SPINE
    PDB Id 1dkf Target Id IGBMC-0012-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23872,P10276 Molecular Weight 50768.50 Da.
    Residues 462 Isoelectric Point 8.21
    Sequence masnssscptpggghlngypvppyafffppmlgglsppgalttlqhqlpvsgystpspatietqsssse eivpsppsppplpriykpcfvcqdkssgyhygvsacegckgffrrsiqknmvytchrdknciinkvtrn rcqycrlqkcfevgmskesvrndrnkkkkevpkpecsesytltpevgeliekvrkahqetfpalcqlgk yttnnsseqrvsldidlwdkfselstkciiktvefakqlpgfttltiadqitllkaacldililrictr ytpeqdtmtfsdgltlnrtqmhnagfgpltdlvfafanqllplemddaetgllsaiclicgdrqdleqp drvdmlqepllealkvyvrkrrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqeml ensegldtlsgqpggggrdggglapppgscspslspssnrsspathsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2620000
    Matthews' coefficent 3.88 Rfactor 0.2030000
    Waters 157 Solvent Content 68.27

    Ligand Information
    Ligands OLA (OLEIC) x 1;BMS (4-[(4,4-DIMETHYL-1,2,3,4-TETRAHYDRO-[1,) x 1
    Metals

    Jmol

     
    Google Scholar output for 1dkf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch