.
The Open Protein Structure Annotation Network
PDB Keyword
.

1bon

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional solution structure of bombyxin-II an insulin-like peptide of the silkmoth Bombyx mori: structural comparison with insulin and relaxin. J.Mol.Biol. 253 749-758 1995
    Site SPINE
    PDB Id 1bon Target Id AF31
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS23832,P76407 Molecular Weight 32036.78 Da.
    Residues 299 Isoelectric Point 4.66
    Sequence maefpasllilngkstdnlplreaimllreegmtihvrvtwekgdaaryveearkfgvatviagggdgt inevstaliqcegddipalgilplgtandfatsvgipealdkalklaiagdaiaidmaqvnkqtcfinm atggfgtrittetpeklkaalgsvsyiihglmrmdtlqpdrceirgenfhwqgdalvigigngrqaggg qqlcpnalindgllqlriftgdeilpalvstlksdednpniiegasswfdiqaphditfnldgeplsgq nfhieilpaalrcrlppdcpllr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1bon

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch