The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of ribose 5-phosphate isomerase from Plasmodium falciparum. Acta Crystallogr.,Sect.F 62 427-431 2006
    Site SGPP
    PDB Id 2f8m Target Id Pfal008434AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14897,PFE0730C Molecular Weight 27228.23 Da.
    Residues 244 Isoelectric Point 7.12
    Sequence mahhhhhhmdslkkivaykavdeyvqsnmtiglgtgstvfyvleridnllksgklkdvvciptsidtel karklgiplttlekhsniditidgtdeidlnlnlikgrggalvreklvasssslfiiigdesklctngl gmtgavpieiltfgyekiienllkiytlkgctykirkrngeifitdnknyivdffftepiqdlletctr ikmttgvvdhgifvnmtnvaliskhdgtvltlnkkye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.2716
    Matthews' coefficent 2.64 Rfactor 0.2085
    Waters 226 Solvent Content 53.35

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2


    Google Scholar output for 2f8m

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch