.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b94

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of P knowlesi homolog of P falciparum PNP. To be Published
    Site SGPP
    PDB Id 2b94 Target Id Pkno008421AAA
    Molecular Characteristics
    Source Plasmodium knowlesi
    Alias Ids TPS14923,PK5_1270C Molecular Weight 29867.85 Da.
    Residues 267 Isoelectric Point 6.12
    Sequence mgsthhhhhhssgrenlyfqghmeeemqrhikltpsqttpvvlvvgdpgrvdkvkmlcdsyvdlaynre yksvectykgqkflcvshgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaavred rvshlmiysdfpavadfevydtlnkvaqelevpvfngislssdlyyphkiiptrledyskanvavveme vatlmvmgtlrkvktggifivdgcplkwdegdfdnnlvpeklenmikisletcarlakky
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.22498
    Matthews' coefficent 2.50 Rfactor 0.18674
    Waters 133 Solvent Content 50.30

    Ligand Information
    Ligands THJ (THIOSULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2b94

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch