.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b4w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein from leishmania major. TO BE PUBLISHED
    Site SGPP
    PDB Id 2b4w Target Id Lmaj006873AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14906,LMJF10.1260 Molecular Weight 35972.07 Da.
    Residues 323 Isoelectric Point 7.18
    Sequence mahhhhhhmkqvkaafeankrvyesvlltfkgvdgydvyncsvpfsykgkthiygrvekrdiwaashvr lfeetgkdeftavpelsweledpyiakinnemifggtrvrkngnailsyygyfyrgtpdeltyftrgpg cmkdirvlqlqdgrlgvfsrprvgrkasigfvilnsidelgaeviakappldilsenawggvnqaylls sgkvgcighysyedtnekqqpqsvyvnyafvldpqsraitgakiigtkscyppcepkvplladcvfasg ivmrsdgkvdlysgvgdshegritidypfkghgtiigdlhfpmassl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.98 Rfree 0.2109
    Matthews' coefficent 2.41 Rfactor
    Waters 185 Solvent Content 48.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b4w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch