The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 A resolution reveals intriguing extra electron density in the active site. Proteins 62 570-577 2006
    Site SGPP
    PDB Id 2b4r Target Id Pfal007254AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14895,PF14_0598 Molecular Weight 37658.39 Da.
    Residues 345 Isoelectric Point 7.66
    Sequence mahhhhhhmavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevt hadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsappkddtp iyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdw ragrcalsniipastgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikka aegplkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswydnewgysnrvldlavhitnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.25 Rfree 0.2428
    Matthews' coefficent 2.10 Rfactor 0.18282
    Waters 257 Solvent Content 40.60

    Ligand Information


    Google Scholar output for 2b4r

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch