The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Characterization of Trypanosoma brucei dihydroorotate dehydrogenase as a possible drug target; structural, kinetic and RNAi studies. Mol.Microbiol. 68 37-50 2008
    Site SGPP
    PDB Id 2b4g Target Id Tbru015978AAA
    Molecular Characteristics
    Source Trypanosoma brucei
    Alias Ids TPS14900,TB927.5.3830 Molecular Weight 34408.84 Da.
    Residues 317 Isoelectric Point 6.27
    Sequence gpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfglplg sinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklapitkekgtilelnlscpnv pgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvi dpanetvvikpkqgfgglggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvg talhdegpiifarlnkelqeimtnkgyktldefrgrvktmd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.24243
    Matthews' coefficent 2.00 Rfactor 0.18894
    Waters 638 Solvent Content 36.90

    Ligand Information
    Ligands FMN (FLAVIN) x 4;ORO (OROTIC) x 4;GOL (GLYCEROL) x 4
    Metals BR (BROMIDE) x 11


    Google Scholar output for 2b4g

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch