.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ar1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Lmaj006129AAA, a hypothetical protein from Leishmania major. Acta Crystallogr.,Sect.F 62 175-179 2006
    Site SGPP
    PDB Id 2ar1 Target Id Lmaj006129AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14917,LMJF36.6870 Molecular Weight 20241.12 Da.
    Residues 172 Isoelectric Point 9.54
    Sequence mahhhhhhmsrkrvraedihywllksephkfsiddlakqktspwdgvrnyaarnnmramsvgdkvlfyh sntkepgvaglaevvrlayddftaldktseyfdpkatkeknpwkmvdvkfvarwdtvltlhelksrrel qkmalftqsrlsvqpvsaseyayilrmneeqqrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.2294
    Matthews' coefficent 1.80 Rfactor 0.185
    Waters 99 Solvent Content 31.40

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2ar1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch