.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a0m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Arginase superfamily protein from Trypanosoma cruzi. TO BE PUBLISHED
    Site SGPP
    PDB Id 2a0m Target Id Tcru010945AAA
    Molecular Characteristics
    Source Trypanosoma cruzi
    Alias Ids TPS14914,TC00.1047053507963.20 Molecular Weight 34611.35 Da.
    Residues 316 Isoelectric Point 6.00
    Sequence mahhhhhhmaartddprllslfsaqreedaeiviigfpydegcvrnggragakkgpaafrfflqrlgsv nnlelnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngramlrafpg dvgvinvdshldvrpplqdgrvhsgtpfrqlleessfsgkrfvefacqgsqcgalhaqyvrdhqghlmw lsevhkkgavaaledafgltgkntffsfdvdslnssdmpgvscpaavglsaqeafdmcflagktptvmm mdmselnplveeyrsprvavymfyhfvlgfatrpkpkaen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.1954
    Matthews' coefficent 1.97 Rfactor 0.168
    Waters 202 Solvent Content 37.45

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2a0m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch