The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein. To be published
    Site SGPP
    PDB Id 1yqf Target Id Lmaj011689AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14907,LMJF30.0970 Molecular Weight 23013.39 Da.
    Residues 203 Isoelectric Point 4.93
    Sequence mahhhhhhmsaptaltvprrsasdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltk sfegedlvvrystnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaea eakrnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.2735
    Matthews' coefficent 2.35 Rfactor 0.2549
    Waters 196 Solvent Content 47.55

    Ligand Information


    Google Scholar output for 1yqf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch