.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yj8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Initial structural analysis of Plasmodium falciparum Glycerol-3-phosphate dehydrogenase. To be Published
    Site SGPP
    PDB Id 1yj8 Target Id Pfal009132AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14898,PFL0780W Molecular Weight 42256.66 Da.
    Residues 375 Isoelectric Point 7.17
    Sequence mahhhhhhmyrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwirdefvngermv diinnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvlasikesesikiashakai sltkgfivkknqmklcsnyisdflnipcsalsganiamdvamenfseatiggndkdslviwqrvfdlpy fkincvnetieveicgalkniitlacgfcdglnlptnsksaiirnginemilfgkvffqkfnenilles cgfadiitsflagrnakcsaefikstpkktweeleneilkgqklqgtvtlkyvyhmikeknmtnefplf tvlhkisfenedpssllktfmnnkinqlnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.85 Rfree 0.25576
    Matthews' coefficent 4.30 Rfactor 0.23607
    Waters 10 Solvent Content 71.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yj8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch