The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Leishmania major ubiquitin conjugating enzyme E2. To be Published
    Site SGPP
    PDB Id 1yf9 Target Id Lmaj005461AAB
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14885,LMJF32.0700 Molecular Weight 19469.95 Da.
    Residues 171 Isoelectric Point 5.95
    Sequence gpgsmsgagnlrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypf kspsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqaahllha drvgfdallrehvsthatpqkalesipeayrph
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.21039
    Matthews' coefficent 4.04 Rfactor 0.18486
    Waters 296 Solvent Content 69.30

    Ligand Information
    Metals CL (CHLORIDE) x 6


    Google Scholar output for 1yf9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch