The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (PTPS). To be Published
    Site SGPP
    PDB Id 1y13 Target Id Pfal004546AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14891,MAL6P1.148 Molecular Weight 21084.88 Da.
    Residues 181 Isoelectric Point 6.30
    Sequence mahhhhhhmmkeetlnsdnssaevsvespsfsfncahfiayngfretlhghnynvslkvrgyvrddgyv idfsilkekvkkvcnkldhhfilpiysdvlkfenvknnikiicednseysfperdciklpikhssteei gqyilnqlieemdvsllksrhihyieisvsesptqkaivhkyi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.23481
    Matthews' coefficent 3.00 Rfactor 0.19536
    Waters 126 Solvent Content 58.10

    Ligand Information
    Ligands BIO (BIOPTERIN) x 3
    Metals ZN (ZINC) x 3


    Google Scholar output for 1y13

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch