The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Phosphoglycerate Mutase from Plasmodium falciparum at 2.6 Resolution. TO BE PUBLISHED
    Site SGPP
    PDB Id 1xq9 Target Id Pfal005984AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14892,PF11_0208 Molecular Weight 29793.73 Da.
    Residues 258 Isoelectric Point 8.31
    Sequence mahhhhhhmttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk raictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsydipppkldked nrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmvaahgnslrglvkhldnls eadvlelniptgvplvyeldenlkpikhyylldseelkkkmdevanqgkak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.58 Rfree 0.27192
    Matthews' coefficent 2.49 Rfactor 0.2073
    Waters 52 Solvent Content 50.65

    Ligand Information
    Ligands SCN (THIOCYANATE) x 3


    Google Scholar output for 1xq9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch