.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xn4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title PUTATIVE MAR1 RIBONUCLEASE FROM LEISHMANIA MAJOR. To be published
    Site SGPP
    PDB Id 1xn4 Target Id Lmaj001686AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14920,LMJF12.0060 Molecular Weight 22610.24 Da.
    Residues 200 Isoelectric Point 7.73
    Sequence mahhhhhhmsrlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhelvpentkyivtehyp kglgrivpgitlpqtahliektrfscivpqveelledvdnavvfgieghacilqtvadlldmnkrvflp kdglgsqkktdfkaamklmgswspnceittsesillqmtkdamdpnfkkiskllkeeppipl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.80 Rfree 0.312
    Matthews' coefficent 2.61 Rfactor 0.313
    Waters Solvent Content 52.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xn4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch