.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xiq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Nucleoside diphosphate kinase B from Plasmodium falciparum. To be Published
    Site SGPP
    PDB Id 1xiq Target Id Pfal006645AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14893,PF13_0349 Molecular Weight 18036.16 Da.
    Residues 157 Isoelectric Point 9.02
    Sequence mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffknl vayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsvasankeiniw fkaeeltqwkhhmkewics
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 3.05 Rfree 0.28608
    Matthews' coefficent 2.30 Rfactor 0.22948
    Waters Solvent Content 45.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xiq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch