The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site SGPP
    PDB Id 1x9g Target Id Ldon001686AAA
    Molecular Characteristics
    Source Leishmania donovani
    Alias Ids TPS14904, Molecular Weight 22610.24 Da.
    Residues 200 Isoelectric Point 7.73
    Sequence mahhhhhhmsrlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhelvpentkyivtehyp kglgrivpgitlpqtahliektrfscivpqveelledvdnavvfgieghacilqtvadlldmnkrvflp kdglgsqkktdfkaamklmgswspnceittsesillqmtkdamdpnfkkiskllkeeppipl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.41 Rfree 0.27567
    Matthews' coefficent 2.94 Rfactor 0.22468
    Waters Solvent Content 58.18

    Ligand Information


    Google Scholar output for 1x9g

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch