.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tc5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of LMAJ005534AAA, a probable eukaryotic D-amino acid tRNA deacylase from Leishmania major. To be Published
    Site SGPP
    PDB Id 1tc5 Target Id Lmaj005534AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14921,LMJF34.3360 Molecular Weight 21738.75 Da.
    Residues 194 Isoelectric Point 7.25
    Sequence mahhhhhhmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllhtk ifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalydrfchfvrvarg vdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegpfthmfdi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.93 Rfree 0.2343
    Matthews' coefficent 2.28 Rfactor 0.19867
    Waters 382 Solvent Content 45.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tc5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch