.
The Open Protein Structure Annotation Network
PDB Keyword
.

1svv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Initial Structural Analysis of Leishmania major Threonine Aldolase. To be Published
    Site SGPP
    PDB Id 1svv Target Id Lmaj008024AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14887,LMJF01.0480 Molecular Weight 40292.10 Da.
    Residues 367 Isoelectric Point 6.25
    Sequence mahhhhhhmstprttataakpkpysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligel lerpdadvhfisggtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvad iesalhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalsspvndlt ladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllgiqfevlmkdnlffe lgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnndfdmytveplkdgtcimrlctsw ateekechrfvevlkrlvasta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.22968
    Matthews' coefficent 2.90 Rfactor 0.19767
    Waters 120 Solvent Content 57.00

    Ligand Information
    Ligands
    Metals UNL (UNKNOWN) x 2

    Jmol

     
    Google Scholar output for 1svv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch