The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of Plasmodium falciparum purine nucleoside phosphorylase complexed with sulfate and its natural substrate inosine. Acta Crystallogr.,Sect.D 61 1245-1254 2005
    Site SGPP
    PDB Id 1sq6 Target Id Pfal008421AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14896,PFE0660C Molecular Weight 27881.76 Da.
    Residues 253 Isoelectric Point 6.45
    Sequence mahhhhhhmdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflc vshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshllihgdfpavg dfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavvemelatlmvigtlrkvkt ggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklatkya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.26501
    Matthews' coefficent 2.10 Rfactor 0.18021
    Waters 48 Solvent Content 41.00

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 1sq6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch