.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hqe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a large fragment of the Human P100 Tudor Domain. To be Published
    Site SECSG
    PDB Id 2hqe Target Id Hsa-P100-TDS
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS9334, Molecular Weight 11483.38 Da.
    Residues 101 Isoelectric Point 6.13
    Sequence vqdvetgtqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyidy gnrevlpstrlgtlspafstrvlpaqateyaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24919
    Matthews' coefficent 1.99 Rfactor 0.23338
    Waters 156 Solvent Content 38.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hqe

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch