The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Green Fluorescent Protein from Clytia Gregaria at 1.55 A resolution. To be Published
    Site SECSG
    PDB Id 2hpw Target Id GFP
    Molecular Characteristics
    Source Clytia gregarium
    Alias Ids TPS9366, Molecular Weight 26366.46 Da.
    Residues 235 Isoelectric Point 5.60
    Sequence mtaltegaklfekeipyitelegdvegmkfiikgegtgdattgtikakyicttgdlpvpwatilsslsy gvfcfakyprhiadffkstqpdgysqdriisfdndgqydvkakvtyengtlynrvtvkgtgfksngnil gmrvlyhspphavyilpdrknggmkieynkafdvmggghqmarhaqfnkplgaweedyplyhhltvwts fgkdpdddetdhltivevikavdletyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.20254
    Matthews' coefficent 2.54 Rfactor 0.18169
    Waters 235 Solvent Content 51.63

    Ligand Information


    Google Scholar output for 2hpw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch