The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein. PHOTOCHEM.PHOTOBIOL.SCI. 7 442-447 2008
    Site SECSG
    PDB Id 2hps Target Id CBP
    Molecular Characteristics
    Source Renilla muelleri (coelenterazine binding protein)
    Alias Ids TPS9317, Molecular Weight 20828.53 Da.
    Residues 186 Isoelectric Point 4.61
    Sequence mpeiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqeflrvadqlg lapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslpefkaflqavgpdltdd kaitcfntldfnkngqisrdeflvtvndflfgleetalanafygdlvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.22887
    Matthews' coefficent 3.12 Rfactor 0.19879
    Waters 176 Solvent Content 60.61

    Ligand Information


    Google Scholar output for 2hps

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch