The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of photoprotein berovin from Beroe abyssicola at 2.00 A resolution. To be Published
    Site SECSG
    PDB Id 2hpk Target Id Bab-Berovin(Ba13)
    Molecular Characteristics
    Source Beroe abyssicola
    Alias Ids TPS9330, Molecular Weight 24872.59 Da.
    Residues 208 Isoelectric Point 4.69
    Sequence mterlneqnnesyrylrsvgnqwqfnvedlhpkmlsrlykrfdtfdldsdgkmemdevlywpdrmrqlv natdeqvekmrdavrvfflhkgvepvngllredwveanrvfaeaerererrgepsliallsnsyydvld ddgdgtvdvdelktmmkafdvpqeaaytffekadtdksgklertelvhlfrkfwmepydpqwdgvyayky
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.26235
    Matthews' coefficent 2.11 Rfactor 0.19857
    Waters 179 Solvent Content 41.75

    Ligand Information
    Metals MG (MAGNESIUM) x 5


    Google Scholar output for 2hpk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch