The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of JW1657 from Escherichia coli at 2.0A resolution. To be Published
    Site SECSG
    PDB Id 2hiq Target Id Eco-JW1657
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS9361, Molecular Weight 13621.74 Da.
    Residues 122 Isoelectric Point 6.28
    Sequence mrgshhhhhhtdpalraatllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggi ylftdeksalaylekhtarlknlgveevvakvfdvneplsqinqaklaglcgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.27
    Matthews' coefficent 3.99 Rfactor 0.249
    Waters 101 Solvent Content 69.19

    Ligand Information


    Google Scholar output for 2hiq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch