.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fzf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Protein Pfu-1136390-001 From Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 2fzf Target Id Pfu-1136390-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9315, Molecular Weight 20838.31 Da.
    Residues 176 Isoelectric Point 5.24
    Sequence mgstiqevreglpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheal lrklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylkleemvkeeekk rlmryladmerghyytlraeyelllnwemysqmmhigp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.299
    Matthews' coefficent 2.34 Rfactor 0.248
    Waters 50 Solvent Content 47.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fzf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch