The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 3-Oxoacyl-[acyl carrier protein] reductase from Thermus thermophilus TT0137. To be Published
    Site SECSG
    PDB Id 2a4k Target Id Tth-TT0137
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS9363, Molecular Weight 27023.52 Da.
    Residues 263 Isoelectric Point 5.58
    Sequence mgrlsgktilvtgaasgigraaldlfaregaslvavdreerllaeavaaleaeaiavvadvsdpkavea vfaealeefgrlhgvahfagvahsalswnlpleawekvlrvnltgsflvarkagevleeggslvltgsv aglgafglahyaagklgvvglartlalelarkgvrvnvllpgliqtpmtaglppwaweqevgasplgra grpeevaqaalfllseesayitgqalyvdggrsivgppglppgfgpkggerhahvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2478
    Matthews' coefficent 2.80 Rfactor 0.2145
    Waters 60 Solvent Content 54.90

    Ligand Information
    Ligands UNX (UNKNOWN) x 28


    Google Scholar output for 2a4k

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch