.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zgh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Methionyl-tRNA formyltransferase from Clostridium thermocellum. To be published
    Site SECSG
    PDB Id 1zgh Target Id Cth-2336
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9307, Molecular Weight 26775.44 Da.
    Residues 230 Isoelectric Point 6.25
    Sequence mniiiattkswniknaqkfkkeneskynttiitnkdeltfekvklinpeyilfphwswiipkeifenft cvvfhmtdlpfgrggsplqnliergikktkisaikvdggidtgdiffkrdldlygtaeeifmraskiif ndmipelltkrpvpqkqegeatvfqrrkpeqseispdfdlekiydyirmldgegyprafikygkyrlef srasmkngkiiadveiiegdene
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.237
    Matthews' coefficent 3.90 Rfactor 0.2086
    Waters 47 Solvent Content 68.00

    Ligand Information
    Ligands UNX (UNKNOWN) x 17
    Metals

    Jmol

     
    Google Scholar output for 1zgh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch