The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Pfu-542154 conserved hypothetical protein. To be Published
    Site SECSG
    PDB Id 1zd0 Target Id Pfu-542154-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9328, Molecular Weight 15915.73 Da.
    Residues 142 Isoelectric Point 5.70
    Sequence mleirtkvgeiciskvwltdeqinklfdrfkgdyqvvnaecadkvifatiiaikavkegrsiaktvpge ilvrlsgnrqikeaikkvgakegenyivtfgenasallqkilstleikelelercdleyakkafediai ieal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.252
    Matthews' coefficent 2.10 Rfactor 0.202
    Waters 93 Solvent Content 40.80

    Ligand Information
    Ligands UNX (UNKNOWN) x 13;MOH (METHANOL) x 3
    Metals MG (MAGNESIUM) x 1


    Google Scholar output for 1zd0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch