.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z2u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.1A crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from Caenorhabditis elegans: functional and evolutionary significance. To be published
    Site SECSG
    PDB Id 1z2u Target Id M7.1
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9297, Molecular Weight 16704.29 Da.
    Residues 147 Isoelectric Point 6.81
    Sequence malkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfptdypfkppkvaf ttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvpeiariyktdrerynqla rewtqkyam
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.10 Rfree 0.1493
    Matthews' coefficent 2.20 Rfactor 0.1305
    Waters 113 Solvent Content 44.20

    Ligand Information
    Ligands BU3 ((R,R)-2,3-BUTANEDIOL) x 2;UNX (UNKNOWN) x 10
    Metals CL (CHLORIDE) x 6;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1z2u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch