.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Genomics of Caenorhabditis Elegans: glutathione S-Transferase. To be Published
    Site SECSG
    PDB Id 1yq1 Target Id F37B1.5
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9292, Molecular Weight 23918.14 Da.
    Residues 208 Isoelectric Point 5.59
    Sequence mpsykltyfffrglgepirllfhlagvqfeevrmnpdqtwldikdstpmkqlpvlnidgfelpqsgail rylarkfgfagktpeeeawvdavhdlfkdflaefkkfaaerrsgksaeevekfrsefflparntyfnil nglleksnsgfligsditfadlvvvdnlltlknyglfdeseftklaalrekvnsypgikeyiakrpvtey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.297
    Matthews' coefficent 2.80 Rfactor 0.224
    Waters 36 Solvent Content 55.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yq1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch