.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yis

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis elegans: adenylosuccinate lyase. To be Published
    Site SECSG
    PDB Id 1yis Target Id R06C7.5
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9291, Molecular Weight 53565.65 Da.
    Residues 478 Isoelectric Point 6.69
    Sequence masedkfesvlstrycknsplvsilsetnkatlwrqlwiwlaeaekelglkqvtqdaidemksnrdvfd wpfirseerklkhdvmahnhafgklcptaagiihlgatscfvqdnadliayrdsidhilkrfatvidrl aafslknkevvtvgrthyqtaslvtvgkrgvlwaqellmafqslsefrdkmrfrgikgatgtqdsfltl fagdeskvealdelvtkkanfsnrflitgqtysrqqdsqlvfslsllgaaakkvctdirvlqafgelle pfekdqigssampykknpmkserccalsrklinapqealtiladqglertlddsagrrmlipdvlltae allttlqnifeglsvqtdnvkkivedeiaflglekammmlteegvdrqqahavirktaleakqlqatqk vdirqtmadpffdsvrdrvvglvnnpinftgrcvsqtesfiakelkptidkyldksagnvqldv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2017
    Matthews' coefficent 2.95 Rfactor 0.174
    Waters 228 Solvent Content 58.00

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yis

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch