.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ycy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1ycy Target Id Pfu-1806301-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9342, Molecular Weight 7969.88 Da.
    Residues 71 Isoelectric Point 4.62
    Sequence mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledinwiml le
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.311
    Matthews' coefficent 2.89 Rfactor 0.281
    Waters Solvent Content 57.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ycy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch