.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Cth-95 from Clostridium thermocellum. To be published
    Site SECSG
    PDB Id 1yby Target Id Cth-95
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9301, Molecular Weight 20652.62 Da.
    Residues 185 Isoelectric Point 5.48
    Sequence misagdfkngvtfeldgqifqviefqhvkpgkgaafvrtklknivtgatiektfnptdkmpkahierkd mqylyndgdlyyfmdtetfeqlplgkdkigdalkfvkeneivkvlshkgnvfgieppnfvelevtdtep gfkgdtatgatkpaivetgasikvplfvnkgdiiridtrtgeymerv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.2704
    Matthews' coefficent 2.50 Rfactor 0.2275
    Waters 198 Solvent Content 50.85

    Ligand Information
    Ligands UNX (UNKNOWN) x 5
    Metals

    Jmol

     
    Google Scholar output for 1yby

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch