The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1y82 Target Id Pfu-367848-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9320, Molecular Weight 17152.43 Da.
    Residues 149 Isoelectric Point 5.28
    Sequence mplppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldvlkdiyni vplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryepmrrfgldtmpldkfvk evelmvekeli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2779
    Matthews' coefficent 2.11 Rfactor 0.2216
    Waters 39 Solvent Content 41.61

    Ligand Information
    Ligands UNX (UNKNOWN) x 42


    Google Scholar output for 1y82

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch