.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y81

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-723267-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1y81 Target Id Pfu-723267-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9360, Molecular Weight 14680.43 Da.
    Residues 130 Isoelectric Point 8.83
    Sequence mnskefrkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcyrsvrelpkdvdvivfvv ppkvglqvakeaveagfkklwfqpgaeseeirrflekagveysfgrcimvetsnkkiflev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.245
    Matthews' coefficent 2.10 Rfactor 0.2226
    Waters 23 Solvent Content 41.44

    Ligand Information
    Ligands SCN (THIOCYANATE) x 1;COA (COENZYME) x 1;UNX (UNKNOWN) x 6;UNX-UNX (UNKNOWN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1y81

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch