.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y80

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a corrinoid (factor IIIm)-binding protein from Moorella thermoacetica. To be published
    Site SECSG
    PDB Id 1y80 Target Id B12
    Molecular Characteristics
    Source Moorella thermoaceticum
    Alias Ids TPS9353, Molecular Weight 22328.56 Da.
    Residues 210 Isoelectric Point 4.47
    Sequence mptyeelsqavfegdeaqvveltrsllsggaeplevinkgliagmdrvgvlfknnemfvpevlmsanam nagvevvkqsqqafdmpsvgkivlgtvkgdlhdigknlvammlesggftvynlgvdiepgkfveavkky qpdivgmsalltttmmnmkstidaliaaglrdrvkvivggaplsqdfadeigadgyapdaasatelcrq lle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2101
    Matthews' coefficent Rfactor 0.17425
    Waters 72 Solvent Content

    Ligand Information
    Ligands B1M (CO-5-METHOXYBENZIMIDAZOLYLCOBAMIDE) x 1;UNX (UNKNOWN) x 5
    Metals

    Jmol

     
    Google Scholar output for 1y80

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch