.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y6j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title L-Lactate Dehydrogenase from Clostridium Thermocellum Cth-1135. To be Published
    Site SECSG
    PDB Id 1y6j Target Id Cth-1135
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9318, Molecular Weight 34831.41 Da.
    Residues 318 Isoelectric Point 5.83
    Sequence memvksrskvaiigagfvgasaaftmalrqtanelvlidvfkekaigeamdinhglpfmgqmslyagdy sdvkdcdvivvtaganrkpgetrldlakknvmiakevtqnimkyynhgvilvvsnpvdiitymiqkwsg lpvgkvigsgtvldsirfryllseklgvdvknvhgyiigehgdsqlplwscthiagknineyiddpkcn fteedkkkiaedvktagatiiknkgatyygiavsintivetllknqntirtvgtvingmygiedvaisl psivnsegvqevlqfnltpeeeealrfsaeqvkkvlnevknl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.01 Rfree 0.271
    Matthews' coefficent 3.79 Rfactor 0.229
    Waters Solvent Content 67.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1y6j

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch