.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xrg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein from Clostridium thermocellum Cth-2968. To be published
    Site SECSG
    PDB Id 1xrg Target Id Cth-2968
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9340, Molecular Weight 13669.04 Da.
    Residues 126 Isoelectric Point 5.20
    Sequence myievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlknvleaagss lnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvlieieavaik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2248
    Matthews' coefficent 2.51 Rfactor 0.1925
    Waters 57 Solvent Content 50.94

    Ligand Information
    Ligands UNX (UNKNOWN) x 17
    Metals

    Jmol

     
    Google Scholar output for 1xrg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch