.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xkq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor. To be Published
    Site SECSG
    PDB Id 1xkq Target Id R05D8.7
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9294, Molecular Weight 29921.55 Da.
    Residues 280 Isoelectric Point 6.59
    Sequence mprfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvnsvvadvtt edgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlklnlqaviemtkkvkphlva skgeivnvssivagpqaqpdflyyaiakaaldqytrstaidlakfgirvnsvspgmvetgftnamgmpd qasqkfynfmashkecipigaagkpehianiilfladrnlsfyilgqsivadggtslvmgtqahdvmsi mssh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.245
    Matthews' coefficent 3.19 Rfactor 0.216
    Waters 628 Solvent Content 62.80

    Ligand Information
    Ligands NDP (NADPH) x 4
    Metals

    Jmol

     
    Google Scholar output for 1xkq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch