.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xi9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Alanine aminotransferase from Pyrococcus furiosus Pfu-1397077-001. To be published
    Site SECSG
    PDB Id 1xi9 Target Id Pfu-1397077-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9331, Molecular Weight 45332.82 Da.
    Residues 398 Isoelectric Point 5.72
    Sequence miraskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmkeayckaikeghnyygds eglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilvpgpsyppytglvkfyg gkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgalydkktleeilniageyeipvisdei ydlmtyegehispgsltkdvpvivmnglskvyfatgwrlgymyfvdpenklsevreaidrlarirlcpn tpaqfaaiagltgpmdylkeymkklkerrdyiykrlneipgisttkpqgafyifpkievgpwkndkefv ldvlhnahvlfvhgsgfgeygaghfravflppieileeamdrfekfmkerlke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.33 Rfree 0.245
    Matthews' coefficent 2.28 Rfactor 0.202
    Waters 105 Solvent Content 45.99

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1xi9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch