The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Away from the edge II: in-house Se-SAS phasing with chromium radiation. Acta Crystallogr.,Sect.D 61 960-966 2005
    Site SECSG
    PDB Id 1xho Target Id Cth-682
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9351, Molecular Weight 13095.45 Da.
    Residues 118 Isoelectric Point 4.95
    Sequence mvwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaarnmgwtst almcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvlrpdlt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.255
    Matthews' coefficent Rfactor 0.194
    Waters 63 Solvent Content

    Ligand Information
    Ligands UNX (UNKNOWN) x 2


    Google Scholar output for 1xho

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch