.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xe1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Protein From Pyrococcus Furiosus Pfu-880080-001. To be published
    Site SECSG
    PDB Id 1xe1 Target Id Pfu-880080-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9333, Molecular Weight 11770.35 Da.
    Residues 108 Isoelectric Point 9.15
    Sequence mglfdflkrkevkeeekieilskkpagkvvveevvnimgkdviigtvesgmigvgfkvkgpsgiggivr iernrekvefaiagdrigisiegkigkvkkgdvleiyqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2397
    Matthews' coefficent 3.25 Rfactor 0.2213
    Waters 28 Solvent Content 62.10

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1xe1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch