The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691 N-Terminal Fragment. TO BE PUBLISHED
    Site SECSG
    PDB Id 1vka Target Id Q15691
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS9355, Molecular Weight 29997.54 Da.
    Residues 268 Isoelectric Point 5.02
    Sequence mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleh eyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaarqgqetava pslvapalnkpkkpltsssaapqrpistqrtaaapkagpgvvrknpgvgngddeaaelmqqvnvlkltv edlekerdfyfgklrnielicqenegendpvlqrivdilyatdegfvipdeggpqeeqeey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2137
    Matthews' coefficent 2.20 Rfactor 0.1998
    Waters 201 Solvent Content 44.00

    Ligand Information


    Google Scholar output for 1vka

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch