.
The Open Protein Structure Annotation Network
PDB Keyword
.

1twl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Inorganic pyrophosphatase from Pyrococcus furiosus Pfu-264096-001. To be published
    Site SECSG
    PDB Id 1twl Target Id Pfu-264096-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9329, Molecular Weight 20912.07 Da.
    Residues 178 Isoelectric Point 4.91
    Sequence mnpfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffypvdygiiprtwyedddp fdimvimrepvypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdiddvpkafldeiahffk rykelqgkeiivegwegaeaakreilraiemykekfgkke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.2574
    Matthews' coefficent 2.08 Rfactor 0.1936
    Waters 35 Solvent Content 40.73

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1twl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch