.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tov

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain. J.Biol.Chem. 277 48596-48601 2002
    Site SECSG
    PDB Id 1tov Target Id F53F4.3
    Related PDB Ids 1lpl 1t0y 
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9283, Molecular Weight 25439.30 Da.
    Residues 229 Isoelectric Point 4.70
    Sequence mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkgeltdgakslk dlgvrdgyrihavdvtggnedfkdesmvekyemsddtygkrtdsvrawkkkmqeeqgsaapmenesdkl neeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkndgsvagvryfdcdpky ggfvrpvdvkvgdfpelsidei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.77 Rfree 0.2587
    Matthews' coefficent 2.82 Rfactor 0.21081
    Waters 81 Solvent Content 56.40

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1tov

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch