.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t9f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function. To be Published
    Site SECSG
    PDB Id 1t9f Target Id R12E2.13
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9280, Molecular Weight 22785.27 Da.
    Residues 206 Isoelectric Point 6.24
    Sequence mpklplllsfpllffasfayadedfvtcysvlkfinandgsrlhshdvkygsgsgqqsvtavknsddin shwqifpalnakcnrgdaikcgdkirlkhlttgtflhshhftaplskqhqevsafgseaesdtgddwtv icngdewleseqfklrhavtgsylslsgqqfgrpihgqrevvgtdsitggsawkvaegiyikhqqkdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.267
    Matthews' coefficent 2.30 Rfactor 0.217
    Waters 130 Solvent Content 46.00

    Ligand Information
    Ligands MLI (MALONATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1t9f

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch