The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis elegans: structure of the BAG domain. Acta Crystallogr.,Sect.D 60 1606-1610 2004
    Site SECSG
    PDB Id 1t7s Target Id AAD16125
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9288, Molecular Weight 24009.02 Da.
    Residues 210 Isoelectric Point 5.20
    Sequence mkvnvscssvqttidileenqgedesiltlgqlrdriatdndvdvetmkllhrgkflqgaddvslstln fkendkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemgkklek kvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndallrrlqeyqsvlngd ipe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.298
    Matthews' coefficent 3.32 Rfactor 0.224
    Waters 50 Solvent Content 62.60

    Ligand Information


    Google Scholar output for 1t7s

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch