.
The Open Protein Structure Annotation Network
PDB Keyword
.

1spx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glucose Dehydrogenase of Caenorhabditis Elegans in the Apo-Form: A Member of the SDR-Family. To be Published
    Site SECSG
    PDB Id 1spx Target Id D1054.8
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9296, Molecular Weight 29365.77 Da.
    Residues 278 Isoelectric Point 6.38
    Sequence mtrfaekvaiitgssngigratavlfaregakvtitgrhaerleetrqqilaagvseqnvnsvvadvtt dagqdeilsttlgkfgkldilvnnagaaipdsqsktgtaqsiesydatlnlnlrsvialtkkavphlss tkgeivnissiasglhatpdfpyysiakaaidqytrntaidliqhgirvnsispglvatgfgsamgmpe etskkfystmatmkecvpagvmgqpqdiaeviafladrktssyiighqlvvdggsslimglhcqdfakllh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.25
    Matthews' coefficent 3.17 Rfactor 0.202
    Waters 145 Solvent Content 60.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1spx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch