.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sl7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin. Protein Sci. 14 663-675 2005
    Site SECSG
    PDB Id 1sl7 Target Id Oob-Ca_H_Obelin
    Molecular Characteristics
    Source Obelia longissima
    Alias Ids TPS9362, Molecular Weight 22224.74 Da.
    Residues 195 Isoelectric Point 4.89
    Sequence msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcve affrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdkdgsgtitldewkay gkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadglygngvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.23938
    Matthews' coefficent 2.13 Rfactor 0.18584
    Waters 110 Solvent Content 42.30

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 3

    Jmol

     
    Google Scholar output for 1sl7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch